PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK00291.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 765aa    MW: 82993.8 Da    PI: 4.4423
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK00291.3genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.91.8e-11134175245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      g+WT +E +ll++a +++  + W+ Ia+++  ++t  qc++++ 
        PK00291.3 134 GKWTDQETLLLLEALELYKEN-WNEIAEHVA-TKTKAQCILHFV 175
                      89*****************88.*********.**********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501359.0873119IPR000433Zinc finger, ZZ-type
SMARTSM002912.9E-973117IPR000433Zinc finger, ZZ-type
SuperFamilySSF578502.83E-1175123No hitNo description
PfamPF005691.1E-876111IPR000433Zinc finger, ZZ-type
CDDcd023363.63E-2277121No hitNo description
PROSITE patternPS01357079105IPR000433Zinc finger, ZZ-type
Gene3DG3DSA:1.10.10.601.8E-8130174IPR009057Homeodomain-like
PROSITE profilePS5129322.079131182IPR017884SANT domain
SuperFamilySSF466899.72E-13131186IPR009057Homeodomain-like
SMARTSM007172.7E-12132180IPR001005SANT/Myb domain
PfamPF002492.4E-11134176IPR001005SANT/Myb domain
CDDcd001670.00147152177No hitNo description
PfamPF164952.4E-24614692IPR032451SMARCC, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 765 aa     Download sequence    Send to blast
XFHPFPPTGP ATGGADDNVA SEKGSLADKL YHFETLQSSK PVIPKNNISA PAVSSRLFPE  60
SSIAEELIRP EGPAVEYHCN SCSADCSRKR YHCQKQADFD LCTDCFNNGK FDSGMSSSDF  120
ILMEPGEMQG LSGGKWTDQE TLLLLEALEL YKENWNEIAE HVATKTKAQC ILHFVQMPIE  180
DSFFDSCDDI EAVDPASSDK LNPKDALETN DSETAINVNQ STSSPMETSK EEMTEVQASQ  240
DTSKHEDTDK GKVDQDTSKL DDGSESKGGK DAEENCAMKA LKEAFEAVGY PLIPERPFSF  300
AEVGNPAMAL AAFLAHLVGP DVATASSHNS LKSLSGNSPG IELASRHCFL LEDPPNDIKE  360
PAGLPSVVAE ATNESFVNEK IEADLPKEDI PTDHCDKKSQ DSVLEAKTLD VPNVETSEIY  420
HSAKEQDIKA GSDEASGSVS TANKSSTPAI VKDQPLSTDD LQSEAEIPPS FVKESEAKTE  480
EPPEPRKTSK EVEMSETTPE KNELQETVPS DVLKEPTNSV DAQVDEPNDS LHSKNNKDQH  540
VTATSVGKPS SEEPRDIDMV PHSGNSEKNE PSQPAEPNVT GEKVVDLTKD RDKKNGMGIK  600
EDTKIDKIKC AAVSAISAAA VKAKLLADEE EDQIRQLSML LIEKQLLKLE TKLGFFNEME  660
NVLMRVREQL DRSRQRLYHE RAQIIAARLG LPASSSRGAS SSLPANRVNI NVTNSVQRPP  720
FSMVSQRPPL SRPMGTVAPT PSIPLSTTTA GSSIGPPSQE KLSSV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010096186.10.0SWI/SNF complex subunit SWI3D
TrEMBLW9R1690.0W9R169_9R
STRINGPOPTR_0009s11780.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF590822